VIP Research Landscape — Research Reference

Vasoactive intestinal peptide (VIP) represents a critical area of investigation within the broader field of neuropeptides, characterized by its wide-ranging biological activities particularly relevant to the immune and vascular systems. Its unique molecular structure and interaction with specific receptor subtypes position it as a significant modulator in numerous physiological processes, making it a compelling subject for extensive preclinical research. The complexity of its signaling pathways and diverse cellular targets underscore the multifaceted nature of VIP’s influence in various biological contexts.

As a vasoactive intestinal peptide, VIP’s mechanism of action and its established roles have attracted considerable scientific attention. The breadth of this interest is reflected by the numerous PubMed publications indexed, which delve into its molecular underpinnings and its observed effects across a spectrum of research models. Furthermore, the progression of VIP research into more advanced investigational stages is evidenced by several registered studies on ClinicalTrials.gov, indicating ongoing exploration of its potential applications as a research tool and its mechanistic investigation in diverse conditions.

Vasoactive Intestinal Peptide: Fundamental Molecular Characteristics

Vasoactive Intestinal Peptide (VIP), a member of the secretin/glucagon superfamily of neuropeptides, is a naturally occurring 28-amino acid polypeptide that exhibits a wide array of biological activities. Recognized as a vasoactive intestinal peptide, its initial discovery was predicated on its potent vasodilatory effects and its presence within the gastrointestinal tract. However, subsequent intensive investigation has profoundly expanded our understanding of VIP’s ubiquitous distribution and multifaceted roles across various physiological systems. The peptide’s broad functional spectrum encompasses significant involvement in immune regulation, neuroprotection, and metabolic homeostasis, making it a pivotal subject of ongoing endocrinology research. The extensive body of work surrounding VIP is evidenced by numerous PubMed publications, alongside several ClinicalTrials.gov registered studies exploring its mechanisms in various research contexts.

The unique primary sequence of VIP (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2) contributes directly to its specific three-dimensional structure and subsequent receptor binding affinity. This peptide is characterized by a significant degree of sequence conservation across species, underscoring its fundamental importance in biological processes. Research elucidating its molecular architecture has revealed an α-helical conformation in solution, which is critical for its interaction with cognate receptors on target cells. This structural stability and specific domain recognition are paramount for VIP to exert its effects, facilitating its role as an important signaling molecule in intercellular communication.

Peptide Structure and Conformational Dynamics

VIP’s structure is typically described as a linear 28-amino acid peptide, but its biological activity is profoundly influenced by its conformational dynamics. The C-terminal amidation is a crucial modification, as it confers resistance to enzymatic degradation and is essential for full biological activity. Studies employing techniques such as circular dichroism and nuclear magnetic resonance have characterized VIP’s propensity to adopt an α-helical structure, particularly when interacting with membrane mimetics or its receptors. This conformational flexibility allows VIP to engage with its high-affinity G protein-coupled receptors, initiating downstream signaling cascades that mediate its diverse physiological effects. Understanding these intricate structural details is vital for the development of VIP analogs and antagonists for specific research applications.

Biosynthesis and Post-Translational Modification

VIP is synthesized as part of a larger precursor molecule, preproVIP, which undergoes extensive post-translational processing to yield the mature peptide. This precursor protein contains multiple copies of VIP-like sequences and a related peptide, peptide histidine isoleucine (PHI) or peptide histidine methionine (PHM) depending on species. The proteolytic cleavage of preproVIP by specific endopeptidases, followed by C-terminal amidation, are critical steps for generating the biologically active VIP molecule. These processes occur primarily in the endoplasmic reticulum and Golgi apparatus of VIP-producing cells, such as neurons and enteroendocrine cells. The precise regulation of these enzymatic steps dictates the bioavailability and tissue-specific expression of VIP, influencing its local and systemic effects in research models.

Physiological Distribution and Diversity

Initially identified in porcine duodenum, VIP’s distribution is remarkably widespread throughout the body, reflecting its broad range of physiological actions. High concentrations of VIP are found within the central and peripheral nervous systems, where it functions as a neurotransmitter and neuromodulator. It is particularly abundant in the enteric nervous system, regulating gut motility and secretion, and within the respiratory, cardiovascular, and genitourinary systems. VIP is also present in immune cells, suggesting its direct involvement in inflammatory and immune responses. This diverse distribution underscores VIP’s significance as a pleiotropic signaling molecule, whose actions are finely tuned by local concentrations and the specific expression patterns of its receptors in different tissues and cell types.

VIP Receptor Systems: Signaling Pathways and Subtypes

The profound biological effects of Vasoactive Intestinal Peptide (VIP) are mediated through its interaction with specific G protein-coupled receptors (GPCRs), primarily the VPAC1 and VPAC2 receptors, which are also known as VIPR1 and VIPR2, respectively. These receptors belong to Class B (or Family 2) of GPCRs, characterized by a large N-terminal extracellular domain involved in ligand binding. The selective activation of VPAC1 or VPAC2, or occasionally PAC1 (a related receptor primarily for pituitary adenylate cyclase-activating polypeptide, PACAP), dictates the specific cellular responses observed across various tissues and organs. Research into these receptor systems is crucial for understanding the precise mechanisms by which VIP exerts its immunomodulatory, neuroprotective, and vasodilatory actions. The differential distribution and coupling of these receptors provide a complex regulatory network for VIP’s pleiotropic functions.

While VIP shows high affinity for both VPAC1 and VPAC2, the subtle differences in their ligand binding pockets and intracellular signaling pathways allow for distinct cellular outcomes. PACAP, a closely related peptide, also binds to VPAC1 and VPAC2 with high affinity, in addition to its primary receptor PAC1. This receptor promiscuity highlights the intricate interplay between VIP and PACAP signaling, suggesting a potential for synergistic or competitive effects depending on the physiological context and peptide concentrations in research models. Deciphering the exact roles of each receptor subtype in specific disease models is a significant focus of ongoing preclinical investigations.

VPAC Receptor Subtypes and Expression

The VPAC1 receptor is widely distributed throughout the body, found in the liver, lung, intestine, T lymphocytes, and various regions of the brain. Its ubiquitous presence suggests a fundamental role in maintaining homeostasis. In contrast, the VPAC2 receptor exhibits a more restricted distribution but is highly expressed in the pancreas, adrenal glands, skeletal muscle, heart, certain brain regions (e.g., suprachiasmatic nucleus), and specific immune cells. The differential expression patterns of VPAC1 and VPAC2 allow for fine-tuning of VIP’s actions, enabling tissue-specific responses. For instance, VPAC1 is often associated with immune cell function, while VPAC2 plays a more prominent role in circadian rhythms and certain metabolic processes. Understanding these distinct expression profiles is critical for designing targeted research studies and interpreting findings from *in vitro* and *in vivo* models.

G-Protein Coupling and Intracellular Cascades

Both VPAC1 and VPAC2 receptors primarily couple to Gs proteins, leading to the activation of adenylyl cyclase and a subsequent increase in intracellular cyclic adenosine monophosphate (cAMP) levels. Elevated cAMP then activates protein kinase A (PKA), which phosphorylates a wide range of intracellular targets, ultimately modifying gene expression, enzyme activity, and cellular processes. Beyond the canonical Gs/cAMP/PKA pathway, research has revealed that VIP receptors can also engage other G proteins, such as Gq, leading to activation of phospholipase C (PLC) and an increase in inositol triphosphate (IP3) and diacylglycerol (DAG), which subsequently mobilize intracellular calcium and activate protein kinase C (PKC). Furthermore, VIP receptors can activate mitogen-activated protein kinase (MAPK) pathways (ERK, JNK, p38) through both Gs-dependent and independent mechanisms. The precise signaling pathway engaged can vary depending on the cell type, receptor subtype, and duration of VIP stimulation.

  • Gs Pathway: Adenylyl cyclase activation → cAMP increase → PKA activation → phosphorylation of target proteins.
  • Gq Pathway: Phospholipase C activation → IP3/DAG production → Ca2+ mobilization & PKC activation.
  • MAPK Pathways: Activation of ERK, JNK, p38 → modulation of cell proliferation, differentiation, and survival.
  • Receptor Desensitization: Beta-arrestin binding → receptor internalization → transient or sustained reduction in responsiveness.

Receptor Regulation and Desensitization

Like many GPCRs, VIP receptors are subject to stringent regulatory mechanisms to prevent overstimulation and to allow for dynamic cellular responses. Prolonged exposure to VIP can lead to receptor desensitization, a process involving phosphorylation of the receptor by GPCR kinases (GRKs) and subsequent binding of β-arrestins. β-arrestin binding uncouples the receptor from G proteins and can trigger receptor internalization into endosomes. This internalization can lead to either receptor recycling back to the cell surface, restoring responsiveness, or receptor degradation, leading to a sustained decrease in receptor number. Understanding these regulatory mechanisms is crucial for interpreting the kinetics of VIP action in experimental models and for developing strategies to modulate VIP signaling in research settings. This intricate control system underscores the precision with which VIP signaling is managed within biological systems.

Immunomodulatory Functions of VIP: A Detailed Research Perspective

Vasoactive Intestinal Peptide (VIP) stands as a prominent endogenous immunomodulator, orchestrating complex effects on both innate and adaptive immune responses. Its widespread presence in immune cells, lymphoid organs, and sites of inflammation underscores its pivotal role in regulating immune homeostasis and influencing disease progression in preclinical models. Research has demonstrated VIP’s capacity to suppress pro-inflammatory mediator production, promote anti-inflammatory cytokines, and modulate the proliferation and differentiation of various immune cell subsets. These actions are primarily mediated through VPAC1 and VPAC2 receptors expressed on immune cells, offering a significant avenue for investigating novel immunoregulatory strategies. The anti-inflammatory properties of VIP have garnered considerable attention, positioning it as a key research target for elucidating mechanisms in chronic inflammatory conditions and autoimmune diseases.

The dual nature of VIP as both a neuropeptide and an immunopeptide highlights the intricate communication between the nervous and immune systems, often referred to as neuroimmunomodulation. Through this crosstalk, VIP helps to integrate systemic responses to stress, infection, and inflammation. Its ability to influence macrophage activation states, T lymphocyte differentiation, and dendritic cell maturation points to a sophisticated regulatory capacity that extends beyond simple immune suppression. Understanding the precise cellular and molecular pathways engaged by VIP in different immune contexts is paramount for advancing our knowledge of immune system regulation and exploring the therapeutic potential of modulating these pathways in research settings. For further details on its cellular effects, consult our page on VIP’s mechanism of action.

VIP’s Impact on Innate Immunity

VIP exerts a significant inhibitory effect on key components of the innate immune system, including macrophages, microglia, and mast cells. In macrophages, VIP has been shown to reduce the production of pro-inflammatory cytokines such as TNF-α, IL-6, and IL-12, while simultaneously promoting the synthesis of anti-inflammatory mediators like IL-10. This shift in cytokine profile contributes to the resolution of inflammation and prevents excessive tissue damage. Furthermore, VIP can suppress the expression of inducible nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2), thereby reducing the production of nitric oxide and prostaglandins, both critical mediators of inflammation. In microglia, the resident immune cells of the brain, VIP diminishes neuroinflammatory responses. Studies in preclinical models of neuroinflammation demonstrate that VIP can attenuate microglial activation, reduce oxidative stress, and limit neuronal damage, suggesting a neuroprotective role.

Adaptive Immune Responses and VIP

VIP significantly influences the adaptive immune system by modulating the function of T lymphocytes, B lymphocytes, and dendritic cells (DCs). It can shift the balance of T helper cell differentiation towards a Th2-biased response, characterized by IL-4 production, and away from pro-inflammatory Th1 and Th17 responses. VIP also promotes the generation of regulatory T cells (Tregs), which are crucial for maintaining immune tolerance and preventing autoimmunity. In dendritic cells, VIP inhibits their maturation and antigen-presenting capacity, reducing their ability to activate naive T cells. This effect can contribute to the suppression of pathogenic immune responses. In B lymphocytes, VIP has been observed to modulate antibody production and cell proliferation, although these effects can be context-dependent. The collective impact of VIP on adaptive immunity points towards a general immunosuppressive and anti-inflammatory role, which has stimulated extensive research into its implications for autoimmune diseases and transplant rejection models.

Therapeutic Research Implications in Immune Disorders

The potent anti-inflammatory and immunomodulatory properties of VIP have positioned it as a compelling subject for preclinical research into various immune-mediated disorders. Studies in animal models of inflammatory bowel disease (IBD), rheumatoid arthritis, multiple sclerosis, and sepsis have consistently demonstrated the beneficial effects of VIP administration, often resulting in reduced inflammation, improved disease markers, and attenuated tissue pathology. For instance, in models of IBD, VIP has been shown to restore gut barrier integrity, reduce inflammatory cell infiltration, and decrease pro-inflammatory cytokine levels. In models of autoimmune arthritis, VIP can suppress joint inflammation and cartilage destruction. However, the exact mechanisms and optimal research strategies for harnessing VIP’s immunomodulatory potential remain areas of active investigation. Future research is focused on developing VIP analogs with improved stability and receptor selectivity, as well as exploring targeted delivery systems, to maximize its immunomodulatory effects while minimizing potential off-target actions in specific research models.

VIP’s Influence on Vascular Biology and Physiology

Vasoactive Intestinal Peptide (VIP) holds a distinguished position in vascular biology due to its potent and widespread vasodilatory properties. Its initial characterization as a “vasoactive” peptide directly reflects this fundamental influence on the cardiovascular system. VIP is an endogenous relaxant of smooth muscle in arteries, arterioles, and veins, contributing significantly to the regulation of local blood flow and systemic arterial pressure in various physiological contexts. The peptide’s actions are mediated primarily through VPAC1 and VPAC2 receptors located on vascular smooth muscle cells and endothelial cells, triggering a cascade of intracellular events that lead to vasodilation. Research in this area explores how VIP contributes to vascular homeostasis, its involvement in various preclinical models of cardiovascular disease, and its potential to modulate endothelial function and angiogenesis.

Beyond its direct effects on vascular smooth muscle, VIP also influences endothelial cell function, a critical aspect of vascular health. The endothelium plays a pivotal role in maintaining vascular tone, regulating coagulation, and controlling inflammatory responses within blood vessels. VIP’s interaction with endothelial cells can modulate the release of other vasoactive substances, further contributing to its complex regulatory role. The vasodilatory action of VIP is not confined to a single vascular bed; it has been observed in cerebral, coronary, pulmonary, renal, and splanchnic circulations, among others. This widespread influence underscores its importance as a physiological regulator of blood flow and highlights its relevance in research pertaining to diverse vascular conditions.

Vasodilatory Actions and Mechanisms

The primary mechanism underlying VIP’s vasodilatory effect involves the activation of adenylyl cyclase and subsequent increase in intracellular cAMP levels within vascular smooth muscle cells. This elevation of cAMP activates protein kinase A (PKA), which phosphorylates various targets, leading to a reduction in intracellular calcium concentration and ultimately smooth muscle relaxation. Key targets of PKA include myosin light chain kinase (MLCK), sarcoplasmic reticulum Ca2+-ATPases, and large-conductance Ca2+-activated K+ channels (BKCa channels). The inhibition of MLCK reduces the phosphorylation of myosin light chain, thereby diminishing the interaction between actin and myosin and leading to relaxation. Activation of BKCa channels causes hyperpolarization of the cell membrane, further contributing to vasodilation. Furthermore, VIP can also stimulate the production of nitric oxide (NO) by endothelial cells, which then diffuses to smooth muscle cells and activates guanylyl cyclase, leading to an increase in cGMP and subsequent relaxation.

Endothelial Cell Function and Angiogenesis

Research indicates that VIP also plays a crucial role in modulating endothelial cell function. Endothelial cells, forming the inner lining of blood vessels, are key regulators of vascular tone and integrity. VIP, by interacting with VPAC receptors on these cells, can stimulate the release of nitric oxide (NO), a potent vasodilator and inhibitor of platelet aggregation. This indirect mechanism further amplifies VIP’s vasodilatory effects. Beyond NO production, VIP has been implicated in regulating endothelial cell proliferation, migration, and survival, processes that are fundamental to angiogenesis – the formation of new blood vessels. Studies suggest that VIP may promote angiogenesis in certain contexts, for example, during wound healing or tissue repair, while potentially inhibiting excessive or pathological angiogenesis in others. The precise role of VIP in angiogenesis is complex and context-dependent, necessitating further investigation in various preclinical models.

Preclinical Models of Vascular Disease

Given its powerful effects on vascular tone and endothelial function, VIP has been a subject of extensive research in preclinical models of various cardiovascular and cerebrovascular diseases. In models of hypertension, VIP administration has been shown to reduce blood pressure, suggesting a potential role in ameliorating vascular resistance. In models of ischemia-reperfusion injury, such as myocardial infarction or stroke, VIP has demonstrated protective effects by reducing infarct size, preserving endothelial function, and mitigating inflammatory responses. Its vasodilatory properties can improve blood flow to compromised tissues, while its anti-inflammatory actions can limit secondary damage. Research also explores VIP’s involvement in atherosclerosis, where its anti-inflammatory effects on endothelial cells and macrophages might contribute to stabilizing plaques and reducing disease progression. These preclinical findings highlight VIP as a promising target for further research into therapeutic strategies for vascular disorders, although the complexities of its pleiotropic actions require careful consideration in experimental design.

Neurological Research Applications of VIP

Vasoactive Intestinal Peptide (VIP) is an abundantly expressed neuropeptide within the central and peripheral nervous systems, where it functions as a neurotransmitter, neuromodulator, and neurotrophic factor. Its widespread distribution throughout the brain, spinal cord, and autonomic ganglia underscores its profound influence on diverse neurological processes, from circadian rhythm regulation to neuroinflammation and neuroprotection. Research into VIP’s neurological roles has expanded significantly, revealing its involvement in synaptic plasticity, neuronal survival, and the intricate communication between neurons and glial cells. The therapeutic research potential of modulating VIP pathways in various neurological disorders, including neurodegenerative diseases, stroke, and mood disorders, remains a compelling area of ongoing investigation.

The neurobiological actions of VIP are mediated through its interactions with VPAC1 and VPAC2 receptors, which are differentially expressed on neurons and glia across various brain regions. The activation of these G protein-coupled receptors triggers a cascade of intracellular signaling events, predominantly involving the cAMP/PKA pathway, but also engaging other pathways such as MAPK and calcium signaling. This complex interplay of signaling mechanisms allows VIP to exert highly specific effects on neuronal excitability, gene expression, and cellular morphology. Understanding the precise distribution and functional coupling of VIP receptors within neural circuits is critical for unraveling the peptide’s intricate roles in brain function and dysfunction.

VIP as a Central Nervous System Modulator

In the central nervous system (CNS), VIP is intimately involved in numerous fundamental processes. It plays a critical role in the regulation of circadian rhythms, with high concentrations found in the suprachiasmatic nucleus (SCN), the brain’s master clock. VIP signaling in the SCN helps to entrain biological rhythms to the light-dark cycle. Beyond circadian regulation, VIP modulates neuronal activity and synaptic transmission. It can influence long-term potentiation (LTP) and long-term depression (LTD), suggesting a role in learning and memory processes. VIP also acts as a powerful vasodilator in the cerebral circulation, contributing to the coupling of neuronal activity with local blood flow (neurovascular coupling). This ability to enhance cerebral blood flow is critical for maintaining metabolic supply to active brain regions and has implications for research into conditions involving cerebral ischemia.

Neuroprotective and Anti-Inflammatory Roles

A significant area of neurological research focuses on VIP’s potent neuroprotective and anti-inflammatory properties within the CNS. In models of acute brain injury, such as stroke or traumatic brain injury, VIP has been shown to attenuate neuronal cell death, reduce cerebral edema, and improve functional outcomes. Its neuroprotective effects are often attributed to its ability to suppress excitotoxicity, mitigate oxidative stress, and reduce apoptosis. Furthermore, VIP acts as a key anti-inflammatory agent in the brain, capable of inhibiting the activation of microglia and astrocytes, which are central players in neuroinflammatory responses. By reducing the release of pro-inflammatory cytokines (e.g., TNF-α, IL-1β) and chemokines from these glial cells, VIP helps to limit the damaging effects of chronic neuroinflammation, a hallmark of many neurodegenerative diseases. This dual capacity for neuroprotection and anti-inflammation makes VIP a highly attractive molecule for research into complex neurological pathologies.

Research in Neurological Disorders

The multifaceted actions of VIP have spurred extensive preclinical research into its potential relevance across a spectrum of neurological disorders. In models of Alzheimer’s disease and Parkinson’s disease, VIP has demonstrated the ability to reduce amyloid-beta plaque formation, improve cognitive function, and protect dopaminergic neurons, respectively. These effects are often linked to its anti-inflammatory and neurotrophic properties. For multiple sclerosis (MS), VIP has shown promise in attenuating demyelination and reducing inflammation in experimental autoimmune encephalomyelitis (EAE) models. Moreover, VIP’s anxiolytic and antidepressant-like effects observed in some animal models suggest its involvement in mood regulation and its potential as a research tool for affective disorders. The intricate nature of VIP’s influence on diverse neural circuits presents both exciting opportunities and significant challenges for further investigation, particularly regarding targeted delivery and receptor subtype specificity in complex disease environments.

Gastrointestinal and Metabolic Research Investigations of VIP

Vasoactive Intestinal Peptide (VIP) plays a fundamental and pleiotropic role in regulating the physiology of the gastrointestinal (GI) tract and is increasingly recognized for its involvement in metabolic homeostasis. VIP is highly abundant in the enteric nervous system, where it acts as a major non-adrenergic, non-cholinergic (NANC) neurotransmitter, influencing virtually every aspect of GI function. Its effects span from modulating gut motility and blood flow to regulating secretion and maintaining the integrity of the intestinal barrier. Recent research has also begun to uncover a nuanced role for VIP in metabolic regulation, including glucose homeostasis, lipid metabolism, and energy balance. These broad actions underscore VIP’s importance in maintaining normal digestive and metabolic health, making it a critical area of research for

Frequently Asked Questions

What is the primary classification of Vasoactive Intestinal Peptide (VIP)?

VIP is classified as a neuropeptide belonging to the secretin/glucagon superfamily of peptides, distinguished by its 28-amino acid structure.

What are the main receptor types for VIP?

The primary receptor types for VIP are VPAC1 and VPAC2 (vasoactive intestinal peptide/pituitary adenylate cyclase-activating polypeptide receptors), which are G protein-coupled receptors involved in mediating its diverse biological effects.

In what key physiological systems is VIP frequently studied?

VIP is extensively studied in the immune system and the vascular system, among others, due to its diverse modulatory functions, including its capacity for vasodilation and immunomodulation.

What are some known aliases for Vasoactive Intestinal Peptide?

The most common alias for Vasoactive Intestinal Peptide is simply VIP.

What is a key mechanism of action attributed to VIP in research models?

VIP’s mechanism of action primarily involves binding to its specific G protein-coupled receptors (VPAC1 and VPAC2), leading to the activation of adenylate cyclase, increased intracellular cyclic AMP (cAMP) levels, and subsequent activation of protein kinase A (PKA), which orchestrates various downstream cellular responses.

How many PubMed publications are indexed for VIP research?

There are numerous PubMed publications indexed for VIP research, signifying its broad and continuous scientific investigation across various disciplines.

Have there been registered studies involving VIP on ClinicalTrials.gov?

Yes, there are several registered studies on ClinicalTrials.gov, indicating the progression of VIP research into various investigational stages, including exploratory studies of its mechanisms in diverse physiological contexts.

What are the general experimental considerations when conducting VIP research?

Experimental considerations for VIP research often include ensuring peptide stability and purity, selecting appropriate *in vitro* or *in vivo* models, optimizing dosing strategies to reflect physiological relevance, and accurately measuring receptor binding, signaling cascades, and specific biological endpoints, while meticulously controlling for potential off-target effects.

Scientific References

All information from Royal Peptide Labs is provided for in-vitro laboratory and research use only — not for human, veterinary, diagnostic, or therapeutic use.

Scroll to Top